User contributions
From 2010.igem.org
(Latest | Earliest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 14:50, 22 October 2010 (diff | hist) Team:TU Delft/Project/conclusions (→Solubility)
- 13:58, 21 October 2010 (diff | hist) Team:TU Delft/Home
- 13:53, 21 October 2010 (diff | hist) Team:TU Delft/Home
- 15:21, 20 October 2010 (diff | hist) Team:TU Delft/Team/organization (→Team Organization)
- 15:18, 20 October 2010 (diff | hist) Team:TU Delft/Team/organization (→Team Organization)
- 12:37, 20 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts
- 12:36, 20 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts
- 12:34, 20 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts (→BBa_K398331: P(Caif)-RBS-GFP-TT)
- 12:27, 20 October 2010 (diff | hist) Team:TU Delft/Project/solubility/parts (→BBa_K398206 - AlnA Emulsifier Protein)
- 12:24, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 12:24, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 12:23, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization
- 12:14, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 12:11, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 12:09, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→RBS Characterization Results)
- 12:08, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 12:08, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→RBS Characterization Results)
- 12:08, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 12:04, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→RBS Characterization Results)
- 18:40, 19 October 2010 (diff | hist) Team:TU Delft/Modeling (→In Silico)
- 18:39, 19 October 2010 (diff | hist) N File:TUDelft 2010 SiliconWithFrame.png (top)
- 18:29, 19 October 2010 (diff | hist) N File:TUDelft2010 Siliconchip.jpg (top)
- 12:44, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:37, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 12:37, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:36, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:31, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:24, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 12:22, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→Parameters) (top)
- 12:21, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→Parameters)
- 12:21, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→How To Use This)
- 12:11, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 12:10, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:06, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:01, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→How To Use This)
- 12:01, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→How To Use This)
- 11:59, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay
- 11:58, 19 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 11:56, 19 October 2010 (diff | hist) N Team:TU Delft/fb photoscroll (Team:TU Delft/fb photoscroll moved to Team:TU Delft/fb photodisplay: it doesnt actually scroll) (top)
- 11:56, 19 October 2010 (diff | hist) m Team:TU Delft/fb photodisplay (Team:TU Delft/fb photoscroll moved to Team:TU Delft/fb photodisplay: it doesnt actually scroll)
- 11:43, 19 October 2010 (diff | hist) Team:TU Delft/Project/tolerance/parts (→Introduction)
- 11:34, 19 October 2010 (diff | hist) Team:TU Delft/Team/organization
- 11:29, 19 October 2010 (diff | hist) Team:TU Delft/Team/organization
- 11:21, 19 October 2010 (diff | hist) Team:TU Delft/Team/organization
- 11:17, 19 October 2010 (diff | hist) Team:TU Delft
- 00:23, 19 October 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 00:20, 19 October 2010 (diff | hist) Team:TU Delft
- 00:19, 19 October 2010 (diff | hist) Team:TU Delft
- 00:06, 19 October 2010 (diff | hist) Team:TU Delft
- 00:04, 19 October 2010 (diff | hist) Team:TU Delft
- 00:00, 19 October 2010 (diff | hist) Team:TU Delft
- 23:33, 18 October 2010 (diff | hist) Team:TU Delft (Undo revision 109795 by Jcnossen (Talk))
- 23:33, 18 October 2010 (diff | hist) Team:TU Delft
- 20:23, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→AlnA) (top)
- 20:23, 18 October 2010 (diff | hist) N File:Protein 2K1S.gif (top)
- 20:21, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 20:17, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→AlkB)
- 20:17, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Prefoldin alpha)
- 20:16, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→bbc1)
- 20:12, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA4)
- 20:10, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→OprG)
- 20:10, 18 October 2010 (diff | hist) N File:Protein 2F1T.gif (top)
- 20:07, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→OprG)
- 20:03, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→AlnA)
- 19:58, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Rubredoxin reductase)
- 19:48, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 19:43, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA3)
- 19:43, 18 October 2010 (diff | hist) N File:Protein 2V3B.gif (top)
- 19:38, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA4)
- 19:37, 18 October 2010 (diff | hist) N File:Protein 2KN9.gif (top)
- 19:31, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Rubredoxin reductase)
- 19:31, 18 October 2010 (diff | hist) N File:Protein 3LB8.gif (top)
- 19:25, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ALDH)
- 19:25, 18 October 2010 (diff | hist) N File:Protein 2WOX.gif (top)
- 19:24, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Prefoldin alpha)
- 19:23, 18 October 2010 (diff | hist) N File:Protein 2ZDI.gif (top)
- 19:23, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ADH)
- 19:22, 18 October 2010 (diff | hist) N File:Protein 1G6K.gif (top)
- 19:20, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Prefoldin alpha)
- 19:17, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Rubredoxin reductase)
- 19:14, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA4)
- 19:00, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 18:56, 18 October 2010 (diff | hist) Team:TU Delft/Home
- 16:57, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 16:56, 18 October 2010 (diff | hist) N File:Protein 3B9N.gif (top)
- 16:14, 18 October 2010 (diff | hist) File:TUDelft 2010 RBS characterization.zip (uploaded a new version of "Image:TUDelft 2010 RBS characterization.zip")
- 16:08, 18 October 2010 (diff | hist) File:TUDelft2010 Rbs strength boxplot.png (uploaded a new version of "Image:TUDelft2010 Rbs strength boxplot.png")
- 15:40, 18 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method)
- 15:38, 18 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Characterization)
- 15:36, 18 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Characterization)
- 15:21, 18 October 2010 (diff | hist) N File:TUDelft2010 Rbs-control-gfp.png (top)
- 15:31, 16 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 16:57, 15 October 2010 (diff | hist) File:TUDelft 2010 AlkanivoreAnimated.gif (uploaded a new version of "Image:TUDelft 2010 AlkanivoreAnimated.gif") (top)
- 16:38, 15 October 2010 (diff | hist) Team:TU Delft
- 16:38, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:32, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:26, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:24, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:23, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:20, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:15, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:15, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:14, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:12, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:11, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:07, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:00, 15 October 2010 (diff | hist) Team:TU Delft/test
- 15:59, 15 October 2010 (diff | hist) Team:TU Delft
- 15:49, 15 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks
- 13:59, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:56, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:49, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:46, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:46, 15 October 2010 (diff | hist) Team:TU Delft
- 13:42, 15 October 2010 (diff | hist) Team:TU Delft
- 13:40, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:23, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:04, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:48, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:24, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:21, 15 October 2010 (diff | hist) Team:TU Delft
- 12:12, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:02, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 16:17, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:17, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:16, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:14, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:13, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:12, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:12, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 21:03, 13 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 16:48, 13 October 2010 (diff | hist) Team:TU Delft/Notebook/timeline
- 16:17, 13 October 2010 (diff | hist) Team:TU Delft/test
- 16:13, 13 October 2010 (diff | hist) File:TUDelft 2010 AlkanivoreAnimated.gif (uploaded a new version of "Image:TUDelft 2010 AlkanivoreAnimated.gif")
- 16:12, 13 October 2010 (diff | hist) Team:TU Delft/test
- 16:08, 13 October 2010 (diff | hist) Team:TU Delft/test
- 16:07, 13 October 2010 (diff | hist) Team:TU Delft/test
- 15:37, 13 October 2010 (diff | hist) N File:TUDelft 2010 AlkanivoreAnimated.gif
- 15:02, 13 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA3)
- 13:38, 13 October 2010 (diff | hist) Team:TU Delft/protein info
- 21:42, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 20:32, 11 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ALDH)
- 20:23, 11 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ALDH)
- 20:17, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 20:08, 11 October 2010 (diff | hist) Team:TU Delft/protein info/bugs (top)
- 20:06, 11 October 2010 (diff | hist) N Team:TU Delft/protein info/bugs (New page: ==Prefoldin alpha== <partinfo>K398400 SequenceAndFeatures</partinfo> ==Prefoldin beta== <partinfo>K398401 SequenceAndFeatures</partinfo>)
- 20:06, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 19:51, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 19:49, 11 October 2010 (diff | hist) N Team:TU Delft/protein info (New page: ==bt-ADH== <partinfo>K398005 SequenceAndFeatures</partinfo> Protein Sequence: NXMSIEQKTAIVTGGANGIGKAIARAFAKQGANVVIIDRDIQNGEAFAAQLQSDGFEAIF VAADVRKVDDIERFVQEAAGRFGRIDYLINNAGVSRWKSPYELTV...)
- 15:04, 8 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts (→Parts)
- 14:13, 8 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts (→Parts)
- 14:12, 8 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 15:11, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 15:00, 7 October 2010 (diff | hist) N File:TUDelft2010 RBS 1754-1611-3-4-i9.gif (top)
- 14:58, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Protein production model)
- 14:56, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Growth curve fitting)
- 14:54, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Protein production model)
- 14:53, 7 October 2010 (diff | hist) N File:TU2010 Gfp explicit.PNG (top)
- 14:33, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 14:33, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Growth curve fitting)
- 14:32, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Plots of measurements)
- 14:30, 7 October 2010 (diff | hist) N File:TUD2010 RBS Growth model.PNG (top)
- 14:25, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 14:24, 7 October 2010 (diff | hist) N File:TUDelft 2010 RBS characterization.zip
- 14:12, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 13:52, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 13:46, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 11:33, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 11:32, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 11:29, 7 October 2010 (diff | hist) N File:TUD2010 Gfpod all.png (top)
- 11:27, 7 October 2010 (diff | hist) N File:RBS Expression model.PNG (top)
- 11:23, 7 October 2010 (diff | hist) File:Tud2010 RBS OD.png (uploaded a new version of "Image:Tud2010 RBS OD.png") (top)
- 11:15, 7 October 2010 (diff | hist) N Team:TU Delft/Project/rbs-characterization/results (New page: The RBS strength defines how much of a protein is produced compared to a reference RBS sequence. However, RBS characterization measurements only include current protein level (GFP measurem...)
- 11:09, 7 October 2010 (diff | hist) N File:TUDelft2010 Rbs strength boxplot.png
- 11:08, 7 October 2010 (diff | hist) N File:Tud2010 RBS OD.png
- 11:03, 7 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks (→Trick 1:)
- 11:01, 7 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks (→Wiki Tips and Tricks)
- 10:57, 7 October 2010 (diff | hist) Team:TU Delft/fb display (top)
- 21:05, 30 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Prefoldin interaction mapping)
- 20:59, 30 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Prefoldin interaction mapping)
- 14:27, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA
- 14:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA (→Metabolic Flux Analysis)
- 14:20, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA (→Metabolic Flux Analysis)
- 14:18, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:16, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:13, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:09, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:09, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:05, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:04, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:03, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:01, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:01, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:55, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:54, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:48, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:48, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:43, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:42, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:41, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:39, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:38, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:38, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:38, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:37, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:37, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:36, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:30, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:28, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:27, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:27, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:24, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:22, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:19, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:19, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:18, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:17, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:17, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:16, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:09, 29 September 2010 (diff | hist) N File:Arrow tud2010.png (arrow image) (top)
- 13:00, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:59, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:59, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:58, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:57, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:54, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:54, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:53, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:50, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:50, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:47, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:46, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:46, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:45, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:45, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:24, 29 September 2010 (diff | hist) N Team:TU Delft/Modeling/MFA/Pathways (New page: <html> <img src="http://dl.dropbox.com/u/602630/omixresults/all%20fluxes.png" style="opacity:0.4;filter:alpha(opacity=40)" /> </html>)
- 12:13, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Alkane degradation pathway interaction mapping)
- 08:05, 27 September 2010 (diff | hist) Team:TU Delft/project/project description
- 19:00, 16 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Prefoldin interaction mapping)
- 14:25, 16 September 2010 (diff | hist) Team:TU Delft/pages/blog (top)
- 14:20, 16 September 2010 (diff | hist) Team:TU Delft/pages/blog
- 14:19, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:19, 16 September 2010 (diff | hist) Team:TU Delft/pages/blogtest (top)
- 14:05, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:05, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:05, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:04, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:03, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:02, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:02, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:01, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:56, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:58, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:58, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:58, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:57, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:57, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:53, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:52, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:52, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:51, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:50, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:41, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:40, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:37, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:36, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:35, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:35, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:34, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:32, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:31, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:30, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:28, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:28, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:28, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 21:35, 15 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping
- 16:33, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:32, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:31, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:27, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:27, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:27, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:25, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:24, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:22, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:22, 15 September 2010 (diff | hist) Team:TU Delft/files/main.js (top)
- 16:14, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:14, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:12, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:03, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:02, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:02, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:00, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:53, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:52, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:41, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:39, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:36, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 15:28, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:28, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:28, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:26, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:22, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:21, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:21, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:19, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:15, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:13, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:13, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:13, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:11, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:11, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:09, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:09, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:08, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:08, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:05, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:03, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:03, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:02, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:57, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:53, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:49, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:48, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:48, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:37, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:35, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:34, 15 September 2010 (diff | hist) m Team:TU Delft/scroll calendar
- 14:29, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:26, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:25, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:22, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:20, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:19, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:16, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:51, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:41, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:40, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:39, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:38, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:38, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:38, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:36, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:36, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:36, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:35, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:35, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:30, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:30, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:22, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:20, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:25, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:24, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:23, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:17, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:16, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:45, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:45, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:45, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:48, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:43, 14 September 2010 (diff | hist) N Team:TU Delft/files/jquery.scrollTo-1.4.2-min.js (New page: /** * jQuery.ScrollTo - Easy element scrolling using jQuery. * Copyright (c) 2007-2009 Ariel Flesler - aflesler(at)gmail(dot)com | http://flesler.blogspot.com * Dual licensed under MIT ...) (top)
- 12:33, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:32, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:26, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:24, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:24, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:23, 14 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 12:20, 14 September 2010 (diff | hist) N Team:TU Delft/scroll calendar (New page: <html> <style> #textWrapper table { margin: 10px; } table.calendar { margin: 0; padding: 10px; } table.calendar td { margin: 0; padding: 2px; vertical-align: top; } table....)
- 11:54, 13 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Result)
- 11:43, 13 September 2010 (diff | hist) Team:TU Delft/Modeling
- 23:29, 12 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Result)
- 23:06, 12 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Result)
- 23:02, 12 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Result)
- 22:59, 12 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Result)
- 22:58, 12 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Result)
- 22:34, 12 September 2010 (diff | hist) N Team:TU Delft/Modeling/software-tool (Redirecting to Team:TU Delft/Modeling/interaction-mapping) (top)
- 22:26, 12 September 2010 (diff | hist) N Team:TU Delft/Modelling/interaction-mapping (Team:TU Delft/Modelling/interaction-mapping moved to Team:TU Delft/Modeling/interaction-mapping) (top)
- 22:26, 12 September 2010 (diff | hist) m Team:TU Delft/Modeling/interaction-mapping (Team:TU Delft/Modelling/interaction-mapping moved to Team:TU Delft/Modeling/interaction-mapping)
- 22:26, 12 September 2010 (diff | hist) Team:TU Delft/Modeling (→Interaction mapping)
- 22:24, 12 September 2010 (diff | hist) Team:TU Delft/Modeling (→Interaction mapping)
- 22:24, 12 September 2010 (diff | hist) Team:TU Delft/Wiki Development (→Wiki Development) (top)
- 13:58, 11 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Searching for interactions)
- 11:09, 11 September 2010 (diff | hist) N File:CytoscapeWeb.swf (http://cytoscapeweb.cytoscape.org) (top)
- 16:33, 10 September 2010 (diff | hist) User:Jcnossen
- 16:33, 10 September 2010 (diff | hist) User:Jcnossen
- 16:25, 10 September 2010 (diff | hist) N User:Jcnossen (New page: I'm Jelmer Cnossen, and doing a master in bioinformatics at TU Delft and Leiden University. I used to be interested in mechanical engineering and game programming, but TED.com and the tal...)
- 15:51, 10 September 2010 (diff | hist) Team:TU Delft/Team
- 15:51, 10 September 2010 (diff | hist) Team:TU Delft/Team
- 15:51, 10 September 2010 (diff | hist) Team:TU Delft/Team (→Team)
- 15:49, 10 September 2010 (diff | hist) N Team:TU Delft/team/team members (Team:TU Delft/team/team members moved to Team:TU Delft/Team/members) (top)
- 15:49, 10 September 2010 (diff | hist) m Team:TU Delft/Team/members (Team:TU Delft/team/team members moved to Team:TU Delft/Team/members)
- 15:45, 10 September 2010 (diff | hist) Team:TU Delft/Team/members
- 15:39, 10 September 2010 (diff | hist) N Team:TU Delft/Project/interaction-mapping (Team:TU Delft/Project/interaction-mapping moved to Team:TU Delft/Modelling/interaction-mapping)
- 15:39, 10 September 2010 (diff | hist) m Team:TU Delft/Modeling/interaction-mapping (Team:TU Delft/Project/interaction-mapping moved to Team:TU Delft/Modelling/interaction-mapping)
- 15:35, 10 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping
- 14:45, 10 September 2010 (diff | hist) N Team:TU Delft/Modeling/interaction-mapping (New page: __NOTOC__ ==Problems with introducing new genes== In our project, we are taking genes from various organisms and putting them as a biobrick plasmid into E. coli. This may cause various un...)
- 14:33, 10 September 2010 (diff | hist) Team:TU Delft/project/software (Redirecting to Team:TU Delft/Project/interaction-mapping)
- 01:36, 10 September 2010 (diff | hist) Team:TU Delft/project/software (→Result)
- 00:49, 10 September 2010 (diff | hist) N Team:TU Delft/Project/rbs-characterization (New page: =Ribosome Binding Site Characterization= Part of our project is to measure the effect of various ribosome binding site (RBS) sequences. A RBS sequence is a specific mRNA sequence that fold...)
- 13:46, 6 September 2010 (diff | hist) Team:TU Delft/basic calendar (top)
- 00:31, 31 August 2010 (diff | hist) Team:TU Delft/30 August 2010 content (Replacing page with 'todo..') (top)
- 22:44, 26 August 2010 (diff | hist) Team:TU Delft/pages/blog
- 10:37, 24 August 2010 (diff | hist) Team:TU Delft/project/rbs characterization (→RBS Characterization)
- 10:34, 24 August 2010 (diff | hist) N File:IGEM TUDelft 2010 Rbs calc.m (top)
- 10:32, 24 August 2010 (diff | hist) N File:Experiment1 26 7 10.m (top)
- 21:14, 22 August 2010 (diff | hist) N Team:TU Delft/19 August 2010 (New page: {{:Team:TU_Delft/calendar_page|day=19|month=August}}) (top)
- 21:13, 22 August 2010 (diff | hist) Team:TU Delft/19 August 2010 content (→Software development)
- 21:13, 22 August 2010 (diff | hist) Team:TU Delft/19 August 2010 content (→Software development)
- 21:02, 22 August 2010 (diff | hist) N Team:TU Delft/19 August 2010 content (New page: ==Software development== Part of the dry lab work involves developing an application that can suggest possible interactions between the newly introduced proteins, and the existing E. coli ...)
- 16:11, 20 August 2010 (diff | hist) Team:TU Delft/project/software (→Software development)
- 16:04, 20 August 2010 (diff | hist) Team:TU Delft/project/software
- 16:02, 20 August 2010 (diff | hist) Team:TU Delft/project/software
- 15:58, 20 August 2010 (diff | hist) N File:IGEMTUDelft Interactiongraph.PNG (top)
- 15:33, 20 August 2010 (diff | hist) Team:TU Delft/project/software
- 15:32, 20 August 2010 (diff | hist) Team:TU Delft/project/software
- 14:45, 20 August 2010 (diff | hist) Team:TU Delft/project/software
- 14:44, 20 August 2010 (diff | hist) Team:TU Delft/project/software
- 13:58, 20 August 2010 (diff | hist) N Team:TU Delft/project/software (New page: ==Problem statement== In our project, we are taking genes from various organisms and putting them as a biobrick plasmid into E. coli. This may cause various unexpected problems in the new...)
- 10:47, 15 August 2010 (diff | hist) Team:TU Delft/pages/home
- 10:45, 15 August 2010 (diff | hist) Team:TU Delft/pages/home
- 12:03, 12 August 2010 (diff | hist) Team:TU Delft/project/genetic regulation
- 12:01, 12 August 2010 (diff | hist) Team:TU Delft/project/genetic regulation
- 10:54, 12 August 2010 (diff | hist) File:TUDelft 2010 AlkS Schema.PNG (uploaded a new version of "Image:TUDelft 2010 AlkS Schema.PNG") (top)
- 10:49, 12 August 2010 (diff | hist) Team:TU Delft/project/modeling/sensing (→Modelling of hydrocarbon sensing)
- 09:50, 12 August 2010 (diff | hist) Team:TU Delft/project/modeling (→Modeling)
- 09:49, 12 August 2010 (diff | hist) Team:TU Delft/project/modeling (→Modeling)
- 09:41, 12 August 2010 (diff | hist) N Team:TU Delft/project/modeling/sensing (New page: =Modelling of hydrocarbon sensing= To characterize the hydrocarbon sensing system (AlkS and promotors), a model has to be build that describes ...)
- 08:48, 12 August 2010 (diff | hist) Team:TU Delft/11 August 2010 content (→Modelling of hydrocarbon sensing)
- 08:47, 12 August 2010 (diff | hist) Team:TU Delft/11 August 2010 content (→Modelling of hydrocarbon sensing)
- 08:46, 12 August 2010 (diff | hist) Team:TU Delft/11 August 2010 content
- 08:46, 12 August 2010 (diff | hist) N File:TUDelft AlkS First output.png (top)
- 08:18, 12 August 2010 (diff | hist) N File:TUDelft 2010 AlkS Schema.PNG
- 14:00, 5 August 2010 (diff | hist) N Team:TU Delft/project/genetic regulation/model (New page: <math>[2]</math>) (top)
- 10:59, 5 August 2010 (diff | hist) Team:TU Delft/menu
- 10:58, 5 August 2010 (diff | hist) Team:TU Delft/menu
- 09:23, 5 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 09:21, 5 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 11:54, 4 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 11:52, 4 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 11:49, 4 August 2010 (diff | hist) Team:TU Delft/files/main test.js (top)
- 11:47, 4 August 2010 (diff | hist) Team:TU Delft/files/main test.js
- 10:31, 4 August 2010 (diff | hist) Team:TU Delft/files/main test.js
- 10:18, 4 August 2010 (diff | hist) Team:TU Delft/files/main test.js
- 10:12, 4 August 2010 (diff | hist) Team:TU Delft/files/main test.js
- 10:09, 4 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 10:09, 4 August 2010 (diff | hist) Team:TU Delft/files/main test.js
- 10:08, 4 August 2010 (diff | hist) Team:TU Delft/test2 (top)
- 10:07, 4 August 2010 (diff | hist) N Team:TU Delft/files/main test.js (New page: //Global Vars var currentPage; function dbgout(msg) { var is_chrome = navigator.userAgent.toLowerCase().indexOf('chrome') > -1; if(is_chrome) console.log(msg); } // Set document rea...)
- 10:04, 4 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 10:01, 4 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 15:11, 3 August 2010 (diff | hist) Team:TU Delft/30 August 2010 content
- 14:00, 3 August 2010 (diff | hist) Team:TU Delft/pages/blog
- 14:00, 3 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 13:01, 3 August 2010 (diff | hist) Team:TU Delft
- 12:56, 3 August 2010 (diff | hist) Team:TU Delft/left
- 12:52, 3 August 2010 (diff | hist) Team:TU Delft/30 August 2010 content (Removing all content from page)
- 12:51, 3 August 2010 (diff | hist) Team:TU Delft/1 August 2010 content (→Alkane Sensing, Solvent Tolerance and Salt Tolerance) (top)
- 12:50, 3 August 2010 (diff | hist) Team:TU Delft/29 July 2010 content (→Plasmid isolation)
- 12:50, 3 August 2010 (diff | hist) Team:TU Delft/28 July 2010 content (→Alkane degradation)
- 12:49, 3 August 2010 (diff | hist) Team:TU Delft/27 July 2010 content (→Alkane degradation)
- 12:48, 3 August 2010 (diff | hist) Team:TU Delft/26 July 2010 content (→Alkane Degradation)
- 12:48, 3 August 2010 (diff | hist) Team:TU Delft/23 July 2010 content (→Alkane Degradation)
- 12:47, 3 August 2010 (diff | hist) Team:TU Delft/22 July 2010 content (→Alkane degradation)
- 12:47, 3 August 2010 (diff | hist) Team:TU Delft/21 July 2010 content (→Ordered DNA)
- 12:46, 3 August 2010 (diff | hist) Team:TU Delft/20 July 2010 content (→Assembly of reference construct)
- 12:46, 3 August 2010 (diff | hist) Team:TU Delft/20 July 2010 content (→Alkane degradation)
- 12:45, 3 August 2010 (diff | hist) Team:TU Delft/19 July 2010 content (→Characterization of Anderson RBS sequences)
- 12:44, 3 August 2010 (diff | hist) Team:TU Delft/19 July 2010 content (→Ordered DNA + Solvent Tolerance and Hydrocarbon Sensing)
- 12:44, 3 August 2010 (diff | hist) Team:TU Delft/16 July 2010 content (→Assembly of reference construct & positive control)
- 12:43, 3 August 2010 (diff | hist) Team:TU Delft/16 July 2010 content (→Ordered DNA + Solvent Tolerance and Hydrocarbon Sensing)
- 12:43, 3 August 2010 (diff | hist) Team:TU Delft/15 July 2010 content (→Fluorescence measurements attempt #2:)
- 12:42, 3 August 2010 (diff | hist) Team:TU Delft/15 July 2010 content (→Emulsifier)
- 12:42, 3 August 2010 (diff | hist) Team:TU Delft/15 July 2010 content (→Ordered DNA + Solvent Tolerance and Hydrocarbon Sensing)
- 12:39, 3 August 2010 (diff | hist) Team:TU Delft/14 July 2010 content (→Ordered DNA)
- 12:38, 3 August 2010 (diff | hist) Team:TU Delft/12 July 2010 content (→Characterization of Anderson RBS sequences) (top)
- 12:37, 3 August 2010 (diff | hist) Team:TU Delft/9 July 2010 content (→Ordered DNA stocks) (top)
- 12:37, 3 August 2010 (diff | hist) Team:TU Delft/8 July 2010 content (→Ordered DNA stocks)
- 12:36, 3 August 2010 (diff | hist) Team:TU Delft/7 July 2010 content (→Ordered DNA stocks) (top)
- 12:31, 3 August 2010 (diff | hist) Team:TU Delft/30 June 2010 content (→BioBrick stocks) (top)
- 12:29, 3 August 2010 (diff | hist) Team:TU Delft/29 June 2010 content (→BioBrick stocks) (top)
- 12:29, 3 August 2010 (diff | hist) Team:TU Delft/24 June 2010 content (→Characterization of Anderson RBS sequences) (top)
- 12:28, 3 August 2010 (diff | hist) Team:TU Delft/23 June 2010 content (→Characterization of Anderson RBS sequences)
- 12:26, 3 August 2010 (diff | hist) Team:TU Delft/23 June 2010 content (→Characterization of Anderson RBS sequences)
- 12:24, 3 August 2010 (diff | hist) Team:TU Delft/pages/blog
- 12:21, 3 August 2010 (diff | hist) Team:TU Delft/9 June 2010 content (→BioBrick stocks)
- 12:21, 3 August 2010 (diff | hist) Team:TU Delft/8 June 2010 content (→BioBrick stocks)
- 12:17, 3 August 2010 (diff | hist) Team:TU Delft/pages/blog
- 12:12, 3 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 12:11, 3 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 12:09, 3 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 12:09, 3 August 2010 (diff | hist) Team:TU Delft/pages/blog
- 12:08, 3 August 2010 (diff | hist) Team:TU Delft/files/main.js
- 11:57, 3 August 2010 (diff | hist) Team:TU Delft/pages/blog
(Latest | Earliest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)