User contributions
From 2010.igem.org
(Latest | Earliest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)
- 23:31, 27 October 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (top)
- 23:25, 27 October 2010 (diff | hist) Team:TU Delft/Software/im-tutorial (top)
- 23:18, 27 October 2010 (diff | hist) N Team:TU Delft/Software/im-tutorial (New page: == Interaction Mapping Application == The interaction mapping application directs the user through a number of steps: Unfortunately a lot of steps are still required, because the data com...)
- 22:07, 27 October 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping
- 20:09, 27 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts (→Cloning method) (top)
- 20:02, 27 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 19:47, 27 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method) (top)
- 16:48, 27 October 2010 (diff | hist) Team:TU Delft/Team/members
- 16:40, 27 October 2010 (diff | hist) Team:TU Delft
- 13:13, 27 October 2010 (diff | hist) Team:TU Delft/Modeling/protein-production-model (→Protein production model) (top)
- 12:31, 27 October 2010 (diff | hist) Team:TU Delft/Collaboration/acknowledgements (→Familiy and Friends)
- 12:28, 27 October 2010 (diff | hist) Team:TU Delft/Parts/characterization (→Ribosome Binding Site (RBS) sequence characterization)
- 12:26, 27 October 2010 (diff | hist) Team:TU Delft/Parts/characterization (→Ribosome Binding Site (RBS) sequence characterization)
- 12:25, 27 October 2010 (diff | hist) Team:TU Delft/Parts/characterization
- 11:46, 27 October 2010 (diff | hist) Team:TU Delft/Project/achievements (→Highlights & Achievements)
- 11:40, 27 October 2010 (diff | hist) Team:TU Delft
- 11:39, 27 October 2010 (diff | hist) Team:TU Delft
- 11:07, 27 October 2010 (diff | hist) Team:TU Delft/Project/conclusions (→Anderson RBS Characterizations)
- 10:35, 27 October 2010 (diff | hist) Team:TU Delft
- 10:15, 27 October 2010 (diff | hist) Team:TU Delft
- 22:15, 26 October 2010 (diff | hist) Team:TU Delft
- 22:14, 26 October 2010 (diff | hist) Team:TU Delft
- 21:21, 26 October 2010 (diff | hist) Team:TU Delft
- 21:15, 26 October 2010 (diff | hist) Team:TU Delft/Project/solubility/characterization (→Our Emulsifier Assay)
- 21:12, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/results (→NADH production in cell extracts)
- 21:10, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/results (→Resting cell assays)
- 21:08, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/results (→NADH production in cell extracts)
- 21:07, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/results (→Resting cell assays)
- 21:06, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/results (→Resting-cell assays)
- 21:03, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/characterization (→Characterization of the long-chain alkane monooxygenase LadA)
- 21:02, 26 October 2010 (diff | hist) Team:TU Delft/Project/alkane-degradation/characterization (→Resting-cell assays)
- 20:57, 26 October 2010 (diff | hist) Team:TU Delft
- 20:56, 26 October 2010 (diff | hist) Team:TU Delft/test (top)
- 20:50, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:46, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:40, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:38, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:36, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:30, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:29, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:28, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:26, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:19, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:17, 26 October 2010 (diff | hist) Team:TU Delft/test
- 20:02, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample (top)
- 20:00, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:59, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:58, 26 October 2010 (diff | hist) Team:TU Delft/Software/part-search (→Why make another webservice?)
- 19:55, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:54, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:54, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:51, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:51, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:49, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:49, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:48, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:48, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:47, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:46, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:44, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:44, 26 October 2010 (diff | hist) N Team:TU Delft/PartViewTest (Team:TU Delft/PartViewTest moved to Team:TU Delft/PartViewExample) (top)
- 19:44, 26 October 2010 (diff | hist) m Team:TU Delft/PartViewExample (Team:TU Delft/PartViewTest moved to Team:TU Delft/PartViewExample)
- 19:43, 26 October 2010 (diff | hist) Team:TU Delft/PartViewExample
- 19:38, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView (top)
- 19:35, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:34, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:32, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:32, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:31, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:24, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:22, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:22, 26 October 2010 (diff | hist) Template:Team:TU Delft/PartView
- 19:07, 26 October 2010 (diff | hist) N Team:TU Delft/PartViewExample (New page: {{Team:TU_Delft/PartView|part=BBa_B0032}})
- 19:07, 26 October 2010 (diff | hist) N Template:Team:TU Delft/PartView (New page: {{{part}}})
- 18:45, 26 October 2010 (diff | hist) Team:TU Delft/Team/members
- 18:36, 26 October 2010 (diff | hist) Team:TU Delft
- 18:36, 26 October 2010 (diff | hist) Team:TU Delft/test
- 16:15, 26 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method)
- 16:12, 26 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method)
- 15:26, 26 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 14:47, 26 October 2010 (diff | hist) Team:TU Delft
- 14:45, 26 October 2010 (diff | hist) Team:TU Delft
- 14:43, 26 October 2010 (diff | hist) Team:TU Delft
- 14:20, 26 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method)
- 14:19, 26 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 14:19, 26 October 2010 (diff | hist) N Team:TU Delft/Modeling/Protein-production-model (Team:TU Delft/Modeling/Protein-production-model moved to Team:TU Delft/Modeling/protein-production-model) (top)
- 14:19, 26 October 2010 (diff | hist) m Team:TU Delft/Modeling/protein-production-model (Team:TU Delft/Modeling/Protein-production-model moved to Team:TU Delft/Modeling/protein-production-model)
- 14:17, 26 October 2010 (diff | hist) N Team:TU Delft/Modeling/protein-production-model (New page: __NOTOC__ {{Team:TU_Delft/frame_check}} ==Protein production model== ===Previous models=== We've noticed that [https://2009.igem.org/Team:Groningen/Promoters previous teams] have performed...)
- 13:46, 26 October 2010 (diff | hist) Team:TU Delft/test
- 13:41, 26 October 2010 (diff | hist) Team:TU Delft/test
- 13:36, 26 October 2010 (diff | hist) Team:TU Delft/test
- 13:18, 26 October 2010 (diff | hist) File:TUDelft 2010 RBS characterization.zip (uploaded a new version of "Image:TUDelft 2010 RBS characterization.zip") (top)
- 13:13, 26 October 2010 (diff | hist) File:TUDelft 2010 RBS strength graph.PNG (uploaded a new version of "Image:TUDelft 2010 RBS strength graph.PNG") (top)
- 13:10, 26 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→The Results)
- 13:10, 26 October 2010 (diff | hist) N File:TUDelft 2010 RBS strength graph.PNG
- 20:05, 25 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method)
- 20:03, 25 October 2010 (diff | hist) N File:TUDelft 2010 PPM Autofluorescence.png (top)
- 19:23, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 19:22, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 19:20, 25 October 2010 (diff | hist) Team:TU Delft/test
- 19:19, 25 October 2010 (diff | hist) Team:TU Delft
- 19:13, 25 October 2010 (diff | hist) Team:TU Delft/Modeling/MFA (→Continue Reading)
- 19:01, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 18:50, 25 October 2010 (diff | hist) Team:TU Delft/test
- 18:42, 25 October 2010 (diff | hist) Team:TU Delft
- 18:39, 25 October 2010 (diff | hist) Team:TU Delft
- 18:32, 25 October 2010 (diff | hist) Team:TU Delft
- 18:22, 25 October 2010 (diff | hist) Team:TU Delft
- 14:37, 25 October 2010 (diff | hist) Team:TU Delft/Team/university (top)
- 14:36, 25 October 2010 (diff | hist) Team:TU Delft/Team/university
- 14:35, 25 October 2010 (diff | hist) Team:TU Delft/Team/university
- 14:25, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 13:51, 25 October 2010 (diff | hist) Team:TU Delft/Modeling (→In Silico)
- 13:49, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search (→Implementation)
- 13:49, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 13:43, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 13:42, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search (→iPhone part browser app)
- 13:41, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search (→iPhone part browser app)
- 13:40, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 13:39, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 13:39, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search
- 13:26, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search (→Part search server)
- 13:04, 25 October 2010 (diff | hist) Team:TU Delft/Software/part-search (→Part search server)
- 12:56, 25 October 2010 (diff | hist) N Team:TU Delft/Software/part-search (New page: __NOTOC__ {{Team:TU_Delft/frame_check}} == Part search server == Because the partsregistry has limited search capabilities, a search service was created, running at: <b>[http://igempartvi...)
- 12:40, 25 October 2010 (diff | hist) N File:TU Delft 2010 Iphone.jpg (top)
- 12:37, 25 October 2010 (diff | hist) Team:TU Delft
- 12:20, 25 October 2010 (diff | hist) Team:TU Delft (Undo revision 143821 by Jcnossen (Talk))
- 12:19, 25 October 2010 (diff | hist) Team:TU Delft
- 11:46, 25 October 2010 (diff | hist) File:TUDelft2010 Rbs strength boxplot.png (uploaded a new version of "Image:TUDelft2010 Rbs strength boxplot.png") (top)
- 11:46, 25 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→Conclusions)
- 11:45, 25 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→Conclusions)
- 11:44, 25 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→Conclusions)
- 11:43, 25 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→Conclusions)
- 11:29, 25 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→The Results)
- 11:23, 25 October 2010 (diff | hist) Team:TU Delft/Collaboration/sponsors (top)
- 13:55, 23 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks
- 13:55, 23 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks
- 13:54, 23 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks (→Wiki Tips and Tricks)
- 13:40, 23 October 2010 (diff | hist) Team:TU Delft/Project (→Sub projects)
- 13:37, 23 October 2010 (diff | hist) Team:TU Delft/Project (→Alkane degradation)
- 13:04, 23 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks (→Trick 3: Photo sources)
- 13:03, 23 October 2010 (diff | hist) Team:TU Delft/fb listalbums (top)
- 13:03, 23 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 13:03, 23 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 13:01, 23 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 18:26, 22 October 2010 (diff | hist) Team:TU Delft/Team/organization (→Team Organization)
- 16:05, 22 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts (→References)
- 16:01, 22 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts (→References)
- 16:00, 22 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts (→References)
- 16:00, 22 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts (→Introduction)
- 14:50, 22 October 2010 (diff | hist) Team:TU Delft/Project/conclusions (→Solubility)
- 13:58, 21 October 2010 (diff | hist) Team:TU Delft/Home
- 13:53, 21 October 2010 (diff | hist) Team:TU Delft/Home
- 15:21, 20 October 2010 (diff | hist) Team:TU Delft/Team/organization (→Team Organization)
- 15:18, 20 October 2010 (diff | hist) Team:TU Delft/Team/organization (→Team Organization)
- 12:37, 20 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts
- 12:36, 20 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts
- 12:34, 20 October 2010 (diff | hist) Team:TU Delft/Project/sensing/parts (→BBa_K398331: P(Caif)-RBS-GFP-TT)
- 12:27, 20 October 2010 (diff | hist) Team:TU Delft/Project/solubility/parts (→BBa_K398206 - AlnA Emulsifier Protein)
- 12:24, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 12:24, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 12:23, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization
- 12:14, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 12:11, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 12:09, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→RBS Characterization Results)
- 12:08, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 12:08, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→RBS Characterization Results)
- 12:08, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 12:04, 20 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results (→RBS Characterization Results)
- 18:40, 19 October 2010 (diff | hist) Team:TU Delft/Modeling (→In Silico)
- 18:39, 19 October 2010 (diff | hist) N File:TUDelft 2010 SiliconWithFrame.png (top)
- 18:29, 19 October 2010 (diff | hist) N File:TUDelft2010 Siliconchip.jpg (top)
- 12:44, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:37, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 12:37, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:36, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:31, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:24, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 12:22, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→Parameters) (top)
- 12:21, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→Parameters)
- 12:21, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→How To Use This)
- 12:11, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums (→Running)
- 12:10, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:06, 19 October 2010 (diff | hist) Team:TU Delft/fb listalbums
- 12:01, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→How To Use This)
- 12:01, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay (→How To Use This)
- 11:59, 19 October 2010 (diff | hist) Team:TU Delft/fb photodisplay
- 11:58, 19 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 11:56, 19 October 2010 (diff | hist) N Team:TU Delft/fb photoscroll (Team:TU Delft/fb photoscroll moved to Team:TU Delft/fb photodisplay: it doesnt actually scroll) (top)
- 11:56, 19 October 2010 (diff | hist) m Team:TU Delft/fb photodisplay (Team:TU Delft/fb photoscroll moved to Team:TU Delft/fb photodisplay: it doesnt actually scroll)
- 11:43, 19 October 2010 (diff | hist) Team:TU Delft/Project/tolerance/parts (→Introduction)
- 11:34, 19 October 2010 (diff | hist) Team:TU Delft/Team/organization
- 11:29, 19 October 2010 (diff | hist) Team:TU Delft/Team/organization
- 11:21, 19 October 2010 (diff | hist) Team:TU Delft/Team/organization
- 11:17, 19 October 2010 (diff | hist) Team:TU Delft
- 00:23, 19 October 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 00:20, 19 October 2010 (diff | hist) Team:TU Delft
- 00:19, 19 October 2010 (diff | hist) Team:TU Delft
- 00:06, 19 October 2010 (diff | hist) Team:TU Delft
- 00:04, 19 October 2010 (diff | hist) Team:TU Delft
- 00:00, 19 October 2010 (diff | hist) Team:TU Delft
- 23:33, 18 October 2010 (diff | hist) Team:TU Delft (Undo revision 109795 by Jcnossen (Talk))
- 23:33, 18 October 2010 (diff | hist) Team:TU Delft
- 20:23, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→AlnA) (top)
- 20:23, 18 October 2010 (diff | hist) N File:Protein 2K1S.gif (top)
- 20:21, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 20:17, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→AlkB)
- 20:17, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Prefoldin alpha)
- 20:16, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→bbc1)
- 20:12, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA4)
- 20:10, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→OprG)
- 20:10, 18 October 2010 (diff | hist) N File:Protein 2F1T.gif (top)
- 20:07, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→OprG)
- 20:03, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→AlnA)
- 19:58, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Rubredoxin reductase)
- 19:48, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 19:43, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA3)
- 19:43, 18 October 2010 (diff | hist) N File:Protein 2V3B.gif (top)
- 19:38, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA4)
- 19:37, 18 October 2010 (diff | hist) N File:Protein 2KN9.gif (top)
- 19:31, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Rubredoxin reductase)
- 19:31, 18 October 2010 (diff | hist) N File:Protein 3LB8.gif (top)
- 19:25, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ALDH)
- 19:25, 18 October 2010 (diff | hist) N File:Protein 2WOX.gif (top)
- 19:24, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Prefoldin alpha)
- 19:23, 18 October 2010 (diff | hist) N File:Protein 2ZDI.gif (top)
- 19:23, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ADH)
- 19:22, 18 October 2010 (diff | hist) N File:Protein 1G6K.gif (top)
- 19:20, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Prefoldin alpha)
- 19:17, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→Rubredoxin reductase)
- 19:14, 18 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA4)
- 19:00, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 18:56, 18 October 2010 (diff | hist) Team:TU Delft/Home
- 16:57, 18 October 2010 (diff | hist) Team:TU Delft/protein info
- 16:56, 18 October 2010 (diff | hist) N File:Protein 3B9N.gif (top)
- 16:14, 18 October 2010 (diff | hist) File:TUDelft 2010 RBS characterization.zip (uploaded a new version of "Image:TUDelft 2010 RBS characterization.zip")
- 16:08, 18 October 2010 (diff | hist) File:TUDelft2010 Rbs strength boxplot.png (uploaded a new version of "Image:TUDelft2010 Rbs strength boxplot.png")
- 15:40, 18 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Data normalization method)
- 15:38, 18 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Characterization)
- 15:36, 18 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Characterization)
- 15:21, 18 October 2010 (diff | hist) N File:TUDelft2010 Rbs-control-gfp.png (top)
- 15:31, 16 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 16:57, 15 October 2010 (diff | hist) File:TUDelft 2010 AlkanivoreAnimated.gif (uploaded a new version of "Image:TUDelft 2010 AlkanivoreAnimated.gif") (top)
- 16:38, 15 October 2010 (diff | hist) Team:TU Delft
- 16:38, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:32, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:26, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:24, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:23, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:20, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:15, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:15, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:14, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:12, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:11, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:07, 15 October 2010 (diff | hist) Team:TU Delft/test
- 16:00, 15 October 2010 (diff | hist) Team:TU Delft/test
- 15:59, 15 October 2010 (diff | hist) Team:TU Delft
- 15:49, 15 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks
- 13:59, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:56, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:49, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:46, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:46, 15 October 2010 (diff | hist) Team:TU Delft
- 13:42, 15 October 2010 (diff | hist) Team:TU Delft
- 13:40, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:23, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 13:04, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:48, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:24, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:21, 15 October 2010 (diff | hist) Team:TU Delft
- 12:12, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 12:02, 15 October 2010 (diff | hist) Team:TU Delft/Notebook/blog
- 16:17, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:17, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:16, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:14, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:13, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:12, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 16:12, 14 October 2010 (diff | hist) Team:TU Delft/Team/gallery
- 21:03, 13 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 16:48, 13 October 2010 (diff | hist) Team:TU Delft/Notebook/timeline
- 16:17, 13 October 2010 (diff | hist) Team:TU Delft/test
- 16:13, 13 October 2010 (diff | hist) File:TUDelft 2010 AlkanivoreAnimated.gif (uploaded a new version of "Image:TUDelft 2010 AlkanivoreAnimated.gif")
- 16:12, 13 October 2010 (diff | hist) Team:TU Delft/test
- 16:08, 13 October 2010 (diff | hist) Team:TU Delft/test
- 16:07, 13 October 2010 (diff | hist) Team:TU Delft/test
- 15:37, 13 October 2010 (diff | hist) N File:TUDelft 2010 AlkanivoreAnimated.gif
- 15:02, 13 October 2010 (diff | hist) Team:TU Delft/protein info (→RubA3)
- 13:38, 13 October 2010 (diff | hist) Team:TU Delft/protein info
- 21:42, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 20:32, 11 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ALDH)
- 20:23, 11 October 2010 (diff | hist) Team:TU Delft/protein info (→bt-ALDH)
- 20:17, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 20:08, 11 October 2010 (diff | hist) Team:TU Delft/protein info/bugs (top)
- 20:06, 11 October 2010 (diff | hist) N Team:TU Delft/protein info/bugs (New page: ==Prefoldin alpha== <partinfo>K398400 SequenceAndFeatures</partinfo> ==Prefoldin beta== <partinfo>K398401 SequenceAndFeatures</partinfo>)
- 20:06, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 19:51, 11 October 2010 (diff | hist) Team:TU Delft/protein info
- 19:49, 11 October 2010 (diff | hist) N Team:TU Delft/protein info (New page: ==bt-ADH== <partinfo>K398005 SequenceAndFeatures</partinfo> Protein Sequence: NXMSIEQKTAIVTGGANGIGKAIARAFAKQGANVVIIDRDIQNGEAFAAQLQSDGFEAIF VAADVRKVDDIERFVQEAAGRFGRIDYLINNAGVSRWKSPYELTV...)
- 15:04, 8 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts (→Parts)
- 14:13, 8 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts (→Parts)
- 14:12, 8 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 15:11, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 15:00, 7 October 2010 (diff | hist) N File:TUDelft2010 RBS 1754-1611-3-4-i9.gif (top)
- 14:58, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Protein production model)
- 14:56, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Growth curve fitting)
- 14:54, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Protein production model)
- 14:53, 7 October 2010 (diff | hist) N File:TU2010 Gfp explicit.PNG (top)
- 14:33, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 14:33, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Growth curve fitting)
- 14:32, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization (→Plots of measurements)
- 14:30, 7 October 2010 (diff | hist) N File:TUD2010 RBS Growth model.PNG (top)
- 14:25, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 14:24, 7 October 2010 (diff | hist) N File:TUDelft 2010 RBS characterization.zip
- 14:12, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/characterization
- 13:52, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/parts
- 13:46, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 11:33, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 11:32, 7 October 2010 (diff | hist) Team:TU Delft/Project/rbs-characterization/results
- 11:29, 7 October 2010 (diff | hist) N File:TUD2010 Gfpod all.png (top)
- 11:27, 7 October 2010 (diff | hist) N File:RBS Expression model.PNG (top)
- 11:23, 7 October 2010 (diff | hist) File:Tud2010 RBS OD.png (uploaded a new version of "Image:Tud2010 RBS OD.png") (top)
- 11:15, 7 October 2010 (diff | hist) N Team:TU Delft/Project/rbs-characterization/results (New page: The RBS strength defines how much of a protein is produced compared to a reference RBS sequence. However, RBS characterization measurements only include current protein level (GFP measurem...)
- 11:09, 7 October 2010 (diff | hist) N File:TUDelft2010 Rbs strength boxplot.png
- 11:08, 7 October 2010 (diff | hist) N File:Tud2010 RBS OD.png
- 11:03, 7 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks (→Trick 1:)
- 11:01, 7 October 2010 (diff | hist) Team:TU Delft/Modeling/wiki-tips-tricks (→Wiki Tips and Tricks)
- 10:57, 7 October 2010 (diff | hist) Team:TU Delft/fb display (top)
- 21:05, 30 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Prefoldin interaction mapping)
- 20:59, 30 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Prefoldin interaction mapping)
- 14:27, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA
- 14:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA (→Metabolic Flux Analysis)
- 14:20, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA (→Metabolic Flux Analysis)
- 14:18, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:16, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:13, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:09, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:09, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:05, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:04, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:03, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:01, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 14:01, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:55, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:54, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:48, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:48, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:43, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:42, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:41, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:39, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:38, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:38, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:38, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:37, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:37, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:36, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:30, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:28, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:27, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:27, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:24, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:23, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:22, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:19, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:19, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:18, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:17, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:17, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:16, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 13:09, 29 September 2010 (diff | hist) N File:Arrow tud2010.png (arrow image) (top)
- 13:00, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:59, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:59, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:58, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:57, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:54, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:54, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:53, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:50, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:50, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:47, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:46, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:46, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:45, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:45, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/MFA/Pathways
- 12:24, 29 September 2010 (diff | hist) N Team:TU Delft/Modeling/MFA/Pathways (New page: <html> <img src="http://dl.dropbox.com/u/602630/omixresults/all%20fluxes.png" style="opacity:0.4;filter:alpha(opacity=40)" /> </html>)
- 12:13, 29 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Alkane degradation pathway interaction mapping)
- 08:05, 27 September 2010 (diff | hist) Team:TU Delft/project/project description
- 19:00, 16 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping (→Prefoldin interaction mapping)
- 14:25, 16 September 2010 (diff | hist) Team:TU Delft/pages/blog (top)
- 14:20, 16 September 2010 (diff | hist) Team:TU Delft/pages/blog
- 14:19, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:19, 16 September 2010 (diff | hist) Team:TU Delft/pages/blogtest (top)
- 14:05, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:05, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:05, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:04, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:03, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:02, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:02, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:01, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:56, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:58, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:58, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:58, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:57, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:57, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:53, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:52, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:52, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:51, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:50, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:41, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:40, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:37, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:36, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:35, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:35, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:34, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:32, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:31, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:30, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:28, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:28, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 00:28, 16 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 21:35, 15 September 2010 (diff | hist) Team:TU Delft/Modeling/interaction-mapping
- 16:33, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:32, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:31, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:27, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:27, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:27, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:25, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:24, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:22, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:22, 15 September 2010 (diff | hist) Team:TU Delft/files/main.js (top)
- 16:14, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:14, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:12, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 16:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:03, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:02, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:02, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 16:00, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:53, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:52, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:41, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:39, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:36, 15 September 2010 (diff | hist) Team:TU Delft/pages/blogtest
- 15:28, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:28, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:28, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:26, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:22, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:21, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:21, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:19, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:15, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:13, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:13, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:13, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:11, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:11, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:10, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:09, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:09, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:08, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:08, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:05, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:03, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:03, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 15:02, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:57, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:53, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:49, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:48, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:48, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:37, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:35, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:34, 15 September 2010 (diff | hist) m Team:TU Delft/scroll calendar
- 14:29, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:26, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:25, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:22, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:20, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:19, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 14:16, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:51, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:41, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:40, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:39, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:38, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:38, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:38, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
- 13:36, 15 September 2010 (diff | hist) Team:TU Delft/scroll calendar
(Latest | Earliest) View (newer 500 | older 500) (20 | 50 | 100 | 250 | 500)