Team:Tianjin/project12

From 2010.igem.org

(Difference between revisions)
Line 129: Line 129:
         <img class="righttext" src="http://2010.igem.org/wiki/images/8/85/Prj12.jpg" />
         <img class="righttext" src="http://2010.igem.org/wiki/images/8/85/Prj12.jpg" />
         <p class="righttext">But our final goal is to display four enzymes on a cell. Those cells, which propagate themselves rapidly, could affix to the wood cellulose material and begin to degrade the lignin quickly with the enzymes of their surface. This yeast will make the lignin degradation pretreatment more secure to our environment and lower the cost. The products of this process are celluase and hemicellulase, which could be used to produce alcohol fuels and papermaking in the next steps.</p>
         <p class="righttext">But our final goal is to display four enzymes on a cell. Those cells, which propagate themselves rapidly, could affix to the wood cellulose material and begin to degrade the lignin quickly with the enzymes of their surface. This yeast will make the lignin degradation pretreatment more secure to our environment and lower the cost. The products of this process are celluase and hemicellulase, which could be used to produce alcohol fuels and papermaking in the next steps.</p>
 +
        <div class="rightsubtitle">Result</div>
 +
        <p class="righttext">Laccase is a polyphenol oxidase, which belongs to the family of blue multicopper oxidases. These enzymes catalyze the one-electron oxidation of four reducing-substrate molecules concomitant with the four-electron reduction of molecular oxygen to water. Laccases oxidize a broad range of substrates, preferably phenolic compounds. 
 +
Geneart optimized the codon (without terminator condon) and synthetized the DNA sequence of laccase.
 +
</p>
 +
        <div class="rightsubtitle">Amino Acid Sequence</div>
 +
        <p class="righttext">MGLQRFSFFVTLALVARSLAAIGPVASLVVANAPVSPDGFLRDAIVVNGVVPSPLITGKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAFVNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDNESTVITLTDWYHTAARLGPRFPLGADATLINGLGRSASTPTAALAVINVQHGKRYRFRLVSISCDPNYTFSIDGHNLTVIEVDGINSQPLLVDSIQIFAAQRYSFVLNANQTVGNYWVRANPNFGTVGFAGGINSAILRYQGAPVAEPTTTQTTSVIPLIETNLHPLARMPVPGSPTPGGVDKALNLAFNFNGTNFFINNATFTPPTVPVLLQILSGAQTAQDLLPAGSVYPLPAHSTIEITLPATALAPGAPHPFHLHGHAFAVVRSAGSTTYNYNDPIFRDVVSTGTPAAGDNVTIRFQTDNPGPWFLHCHIDFHLDAGFAIVFAEDVADVKAANPVPKAWSDLCPIYDGLSEANQ
 +
</p>
 +
        <img class="righttext" src="http://2010.igem.org/wiki/images/7/78/Prj1_lt2.jpg" />
 +
        <img class="righttext" src="http://2010.igem.org/wiki/images/8/86/Prj1_lt3.jpg" />
 +
       
     </div>
     </div>

Revision as of 07:32, 27 October 2010

Untitled Document

Project